PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 264aa    MW: 29857.2 Da    PI: 5.7225
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30199.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv  v ++G ++W+ Ia+  g++Rt+k+c++rw +yl
       KHN30199.1  8 KGPWTEQEDFKLVSFVGLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding54.62.4e-1761106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
       KHN30199.1  61 RGKMTPQEERLVLELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTLM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.206355IPR017930Myb domain
SuperFamilySSF466891.31E-296102IPR009057Homeodomain-like
SMARTSM007171.5E-14757IPR001005SANT/Myb domain
PfamPF002495.6E-15855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-20962IPR009057Homeodomain-like
CDDcd001671.30E-101055No hitNo description
PROSITE profilePS5129426.95756110IPR017930Myb domain
SMARTSM007176.2E-1760108IPR001005SANT/Myb domain
PfamPF002491.0E-1561105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2363109IPR009057Homeodomain-like
CDDcd001673.65E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MVQQEVRKGP WTEQEDFKLV SFVGLFGDRR WDFIAKVSGL NRTGKSCRLR WVNYLHPGLK  60
RGKMTPQEER LVLELHSKWG NRWSRIARKL PGRTDNEIKN YWRTLMRKKA QEKKRGEAAS  120
SSPTPSSVDS SISSNNHAVD PHASKKAGEE SFYDTGGDNG VIAATQDQGQ KGDQQGLFSM  180
DDIWKDIDNM SEENNTTLQP VSVYDGHSEE GCNFSCPPQV PSPSSWEYSS SDPLWVMDEE  240
SLFCPLSEEP YFSCYAQGTV FLTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2951101105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966870.0BT096687.1 Soybean clone JCVI-FLGm-21E3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593490.10.0PREDICTED: MYB transcription factor MYB139 isoform X2
SwissprotQ9LX822e-85MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0B2RCU90.0A0A0B2RCU9_GLYSO; Transcription factor MYB48
TrEMBLK7M3C00.0K7M3C0_SOYBN; Uncharacterized protein
STRINGGLYMA13G40830.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.14e-80myb domain protein 48
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]